Reproductive & Hormonal
Teriparatide
PTH(1-34); rhPTH(1-34); recombinant human parathyroid hormone (1-34); Forteo; Forsteo; Bonsity; parathyroid hormone fragment 1-34
7 min read · Updated July 8, 2026 · 7 references
Teriparatide is an approved prescription medicine — the first anabolic (bone-building) osteoporosis drug (brands Forteo/Forsteo, and follow-on Bonsity). It is a 34-amino-acid fragment of human parathyroid hormone that, given as a once-daily injection, stimulates new bone formation and reduces vertebral and nonvertebral fracture risk in high-risk osteoporosis. Approval applies to the specific licensed products, not to research-grade material, and this page is not medical advice.
Evidence: Regulator-approved drug with human trial evidence.
Approved in: US & EU (osteoporosis)
- First anabolic (bone-forming) osteoporosis drug; FDA-approved November 2002 (Forteo/Forsteo)
- 34-amino-acid fragment identical to the active N-terminus of native human PTH; a PTH1R agonist
- Once-daily (intermittent) dosing builds bone — the opposite of continuous PTH, which is catabolic
- Pivotal RCT (Neer et al., NEJM 2001, n=1637) cut new vertebral and nonvertebral fractures [Human]
- In November 2020 the FDA removed the 2-year lifetime treatment limit and the osteosarcoma boxed warning
- Approval covers licensed products, not research-grade material; not medical advice
Recombinant human parathyroid hormone fragment PTH(1-34), the first anabolic (bone-forming) osteoporosis medicine and a PTH1 receptor agonist. FDA-approved November 2002 (Forteo/Forsteo; EMA June 2003; follow-on Bonsity 2019).
Overview
Teriparatide (PTH(1-34), rhPTH(1-34); brand names Forteo/Forsteo and the follow-on product Bonsity) is a recombinant human parathyroid hormone fragment corresponding to the first 34 amino acids of native, 84-residue human parathyroid hormone (PTH). Unlike most compounds documented on this site, teriparatide is an approved prescription medicine. It was FDA-approved in November 2002 as the first anabolic (bone-forming) agent for osteoporosis, and EMA-approved in June 2003 (marketed in the EU as Forsteo).
Where most osteoporosis drugs (e.g., bisphosphonates) work by slowing bone breakdown, teriparatide is distinctive in that it stimulates new bone formation. It acts as an agonist at the parathyroid hormone 1 receptor (PTH1R), and when given as an intermittent once-daily injection it preferentially favors bone-building over bone resorption.
Approved medicine — this page is not medical advice
Teriparatide is an approved, prescription-only medicine used under medical supervision. The approval applies to the specific licensed products (Forteo/Forsteo, Bonsity), not to research-grade material sold outside the regulated supply chain. This article is educational and is not medical advice; dosing and use must be directed by a clinician. Framing dated 2026-07-08; check your jurisdiction.
Chemistry and structure
Teriparatide is a 34-amino-acid peptide whose sequence is identical to the biologically active N-terminal 1-34 region of human PTH. This N-terminal fragment retains the full receptor-activating biology of the native hormone.
| Property | Value |
|---|---|
| Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (34 residues) |
| Classification | Recombinant human PTH fragment PTH(1-34); PTH1R agonist |
| Molecular formula | C181H291N55O51S2 |
| Molecular weight | ~4117.77 g/mol (a vendor listing gives 4117.72 — same value to rounding) |
| CAS number (reported) | 52232-67-4 (free base); the acetate salt is commonly listed under 99294-94-7 |
Two near-identical published molecular weights
Published molecular weight appears as 4117.77 or 4117.72 g/mol depending on the source and salt form. The free-base CAS (52232-67-4) and MW (~4117.77) were confirmed via Wikipedia and a Sigma-Aldrich substance record; the PubChem fetch returned the molecular formula but the CAS/MW were not directly readable from its chemistry pane.
Mechanism of action
- Acts as an agonist at the parathyroid hormone 1 receptor (PTH1R); the 1-34 fragment retains the full receptor-activating biology of native PTH. [Human] — Source: Wikipedia / FDA label
- Intermittent (once-daily) exposure nets stimulation of osteoblasts more than osteoclasts, driving new bone formation and increased bone mineral density — distinct from the catabolic effect of continuously elevated PTH. [Human] — Source: Wikipedia; Neer et al., NEJM 2001
- Reduces the incidence of new vertebral and nonvertebral fragility fractures in postmenopausal osteoporosis. [Human] — Source: Neer RM et al., NEJM 2001;344:1434-1441
Research and evidence
| Study (year) | Model type | System | Key finding |
|---|---|---|---|
| Neer RM et al. (2001) | Human RCT | Postmenopausal women with prior vertebral fracture (n=1637); 20 or 40 µg/day s.c. vs placebo, median 19 months | Significantly reduced new vertebral and nonvertebral fractures; increased lumbar-spine BMD |
| Tashjian AH et al. (2006) | Human (post-marketing review) | Post-approval use/safety experience | 2.5 years of post-approval use and safety reported; supported use in osteoporosis |
| Saag KG et al. (2007) | Human RCT | Glucocorticoid-induced osteoporosis, teriparatide vs alendronate | Teriparatide superior to alendronate for BMD |
| FDA label change (2020) | Regulatory | US labeling | November 2020 FDA label change removed the 2-year lifetime limit and the osteosarcoma boxed warning |
Human evidence. Teriparatide has strong Phase 3 human evidence. The pivotal Fracture Prevention Trial (Neer et al., NEJM 2001) randomized 1,637 postmenopausal women with prior vertebral fractures to teriparatide (20 or 40 µg/day subcutaneously) or placebo for a median of 19 months, and found significant reductions in new vertebral and nonvertebral fragility fractures alongside increased lumbar-spine bone mineral density [Human, RCT]. More than two decades of post-marketing use are documented [Human], and teriparatide has been studied extensively in glucocorticoid-induced and male osteoporosis in randomized trials (e.g., teriparatide vs alendronate in glucocorticoid-induced osteoporosis, NEJM 2007) [Human, RCT].
Status and regulation
- United States (FDA — approved): Approved November 2002 as Forteo (Eli Lilly), the first anabolic bone agent for osteoporosis. A follow-on product, Bonsity, was FDA-approved in October 2019. In November 2020, the FDA removed the prior 2-year lifetime treatment limitation and the boxed warning regarding potential osteosarcoma risk from the label.
- European Union (EMA — approved): Approved June 2003, marketed in the EU as Forsteo. (EMA approval month is per Wikipedia; the primary EMA EPAR for Forsteo was not independently fetched.)
- Indications: postmenopausal women and men with osteoporosis at high fracture risk, and glucocorticoid-induced osteoporosis.
- WADA status: Not established / not found in sources. No source in this research explicitly lists teriparatide on the WADA Prohibited List or assigns it an S-class code; no class is asserted by inference. Verify against the official current WADA Prohibited List (wada-ama.org) if sport-eligibility matters.
Safety
- As an approved prescription medicine, teriparatide is used under clinician supervision with product-specific labeling; it is not intended for self-directed use.
- The prior label carried a boxed warning about a theoretical osteosarcoma risk (based on rat studies); the FDA removed this boxed warning in November 2020 along with the 2-year lifetime treatment limit.
- Detailed adverse-effect, contraindication, and monitoring information: Not established / not found in sources here — consult the current FDA/EMA prescribing information.
Approved medicine — use only under a clinician
Teriparatide is a prescription-only anabolic osteoporosis medicine. The approval covers the licensed products (Forteo/Forsteo, Bonsity), not research-grade material. Material sold outside the regulated pharmaceutical supply chain is not the approved medicine and cannot be assumed to match it for identity, potency, sterility, or purity. This page is not medical advice; dosing and use must be directed by a qualified clinician.
Legal status
Teriparatide is an approved medicine in the United States (FDA) and the European Union (EMA). Its regulatory status is that of a prescription-only pharmaceutical for its licensed osteoporosis indications. Approval attaches to the specific licensed products (Forteo/Forsteo, Bonsity), not to research-grade peptide material sold outside the regulated supply chain — such material is not the approved medicine and becomes an unauthorised medicine the moment it is intended for human use. WADA sport-prohibition is a separate axis from legality; no WADA class is asserted here (see Status and regulation). Legal specifics vary by country; this is a regulatory reference, not legal advice — check your jurisdiction. Framing dated 2026-07-08.
How it compares
Teriparatide is one of the few approved peptide medicines documented here. Among the growth/hormonal-axis peptides in our set, the closest comparators by regulatory standing are the growth-hormone-axis agents rather than direct bone analogs:
- Tesamorelin — an FDA-approved GHRH analog, but for a different indication (HIV-associated visceral fat), acting on the GH/IGF-1 axis rather than the PTH1 receptor.
- Sermorelin — a related GHRH-axis peptide, previously approved and now discontinued/compounded.
These act through entirely different receptors and pathways; teriparatide's mechanism (PTH1R agonism driving bone formation) is distinct. Most other peptides in our set are research chemicals without regulatory approval, and should not be assumed to share teriparatide's evidence base or approval standing.
Common misconceptions
- "Teriparatide is just parathyroid hormone, which weakens bones." Continuous PTH elevation is catabolic and can weaken bone, but intermittent once-daily teriparatide nets osteoblast stimulation over osteoclast activity, building new bone. [Human]
- "It still carries a black-box osteosarcoma warning and a 2-year limit." The FDA removed both the boxed warning and the 2-year lifetime treatment limitation from the label in November 2020.
- "Research-grade PTH(1-34) is the same as the approved drug." The approval applies only to the licensed products (Forteo/Forsteo, Bonsity). Research-grade material is not the approved medicine and cannot be assumed equivalent for identity, potency, or purity.
- "Teriparatide is a weight-loss or performance peptide." Its approved indications are osteoporosis (postmenopausal, male, and glucocorticoid-induced) at high fracture risk — not body composition or performance.
This article is provided for educational purposes only and is not medical advice. Teriparatide (Forteo/Forsteo, Bonsity) is a prescription medicine that should be used only under the supervision of a qualified healthcare professional. Approval applies to the specific licensed products, not to research-grade material. Framing dated 2026-07-08; check your jurisdiction.
References
- 1.Effect of Parathyroid Hormone (1-34) on Fractures and Bone Mineral Density in Postmenopausal Women with Osteoporosis (Fracture Prevention Trial) — Neer RM, Arnaud CD, Zanchetta JR, et al., New England Journal of Medicine, 2001. source
- 2.Teriparatide [Human PTH(1-34)]: 2.5 Years of Experience on the Use and Safety of the Drug for the Treatment of Osteoporosis — Tashjian AH Jr, Gagel RF, Journal of Bone and Mineral Research, 2006. source
- 3.Teriparatide or Alendronate in Glucocorticoid-Induced Osteoporosis — Saag KG, Shane E, Boonen S, et al., New England Journal of Medicine, 2007. source
- 4.Teriparatide: Label changes and long-term use — Cleveland Clinic Journal of Medicine, Cleveland Clinic Journal of Medicine, 2021. source
- 5.FORTEO (teriparatide) injection — Full Prescribing Information — U.S. Food and Drug Administration / Eli Lilly, FDA Drugs@FDA Label Repository, 2020. source
- 6.Teriparatide — PubChem (CID 16133850) — National Center for Biotechnology Information, PubChem Compound Database, 2026. source
- 7.
Frequently asked questions
- What is Teriparatide?
- Recombinant human parathyroid hormone fragment PTH(1-34), the first anabolic (bone-forming) osteoporosis medicine and a PTH1 receptor agonist. FDA-approved November 2002 (Forteo/Forsteo; EMA June 2003; follow-on Bonsity 2019).
- Is Teriparatide approved as a medicine, and where?
- It is an approved prescription medicine, but where it is approved matters: US & EU (osteoporosis). It should only be used under medical supervision.
- What is Teriparatide studied for?
- Teriparatide is most often discussed in the context of longevity & cellular health. Research has examined Bone formation / anabolic bone therapy, Postmenopausal and male osteoporosis, and Glucocorticoid-induced osteoporosis. Being studied for an area does not mean it is proven or approved for it.
- Does Teriparatide have human clinical trials?
- Yes. Teriparatide has been studied in human clinical trials and is an approved medicine in at least some regions.
Educational disclaimer. This article summarizes published research for informational purposes and is not medical advice. Teriparatide is a research chemical not approved for human use. Consult a qualified healthcare professional before making health decisions.