Immune & Thymic
LL-37
Cathelicidin; hCAP-18 C-terminal peptide; CAMP; LL37
12 min read · Updated June 25, 2026 · 13 references
LL-37 is the only human cathelicidin antimicrobial peptide, a fragment of hCAP-18 central to innate immunity; its biology is genuinely double-edged, protective yet also implicated in autoimmune disease and context-dependent in cancer. It is an endogenous peptide, not an approved drug; the only controlled human evidence comes from small topical wound-healing trials, with no systemic use established.
Evidence: Only small/early human studies; not approved.
- The only human cathelicidin; C-terminal fragment of hCAP-18.
- Direct antimicrobial plus immunomodulation, chemotaxis, angiogenesis, wound healing.
- Double-edged, implicated in psoriasis, lupus, and rosacea.
- Context-dependent in cancer, both pro- and anti-tumor.
- Endogenous peptide; not approved. Human data limited to small topical wound-healing trials.
The only human cathelicidin antimicrobial peptide, a 37-residue fragment released from the precursor protein hCAP-18. It is an endogenous component of innate immunity with direct antimicrobial, immunomodulatory, chemotactic, angiogenic, and wound-healing activities, but it has strikingly double-edged biology, it is also implicated in inflammatory and autoimmune diseases and has context-dependent roles in cancer. It is not an approved drug; the only controlled human data come from small topical wound-healing trials, with no systemic dosing established.
Overview
LL-37 is the only cathelicidin antimicrobial peptide known to be produced in humans. It is not a designed drug but an endogenous peptide: it is released by enzymatic cleavage from a larger precursor protein called hCAP-18 (human cationic antimicrobial protein, 18 kDa), itself the product of the CAMP gene. The mature peptide is the C-terminal 37-amino-acid fragment of hCAP-18, and its name comes from its first two residues (two leucines, "LL") followed by its length (37 residues).
LL-37 is a central player in innate immunity, the body's rapid, non-specific first line of defense. It is expressed by neutrophils, and by epithelial cells of the skin, airway, gut, and other surfaces, where it contributes to host defense. Its reported activities are unusually broad: direct killing of microbes, neutralization of bacterial lipopolysaccharide (LPS), recruitment of immune cells (chemotaxis), modulation of inflammation, promotion of new blood-vessel formation (angiogenesis), and support of wound healing.
A defining and important feature of LL-37 is that its biology is genuinely double-edged. The same peptide that defends against infection has also been implicated in driving inflammatory and autoimmune diseases, and it plays context-dependent roles in cancer, promoting some tumors while suppressing others. This makes LL-37 a subject of intense research interest, but also a cautionary example of why "natural" and "part of the immune system" do not mean "uniformly beneficial" or "safe to administer."
Double-edged biology; not an approved drug
LL-37 is not an approved medicine. It is an endogenous human peptide studied in laboratory and animal research. Its activities are genuinely double-edged: it is protective in host defense but is also implicated in autoimmune and inflammatory diseases (psoriasis, lupus, rosacea) and has context-dependent effects in cancer (both pro- and anti-tumor). The only controlled human data come from small topical wound-healing trials (venous leg ulcers, diabetic foot ulcers); there is no established systemic dosing, and the consequences of administering it exogenously by other routes in humans are not established.
Chemistry and structure
LL-37 is a short, cationic (positively charged), amphipathic peptide. In aqueous or membrane-mimicking environments it tends to adopt an alpha-helical structure, and its amphipathic helix — segregating hydrophobic and positively charged residues — underlies much of its interaction with microbial membranes and host cells.
| Property | Value |
|---|---|
| Classification | Endogenous human cathelicidin antimicrobial peptide |
| Length | 37 amino acid residues |
| One-letter sequence | [LL-37, 37 aa] |
| Approx. molecular weight | ~4493 g/mol |
| Precursor | hCAP-18 (CAMP gene product); LL-37 is its C-terminal fragment |
| Net charge | Cationic (multiple Lys/Arg residues) |
| Secondary structure | Predominantly alpha-helical in membrane/helix-promoting conditions |
The precursor hCAP-18 consists of an N-terminal cathelin-like domain and the C-terminal antimicrobial peptide. Proteolytic processing, for example by serine proteases such as proteinase 3 in neutrophils, or kallikreins in skin, releases LL-37 (and, depending on the protease, shorter or alternative fragments). Because activity depends heavily on which fragments are generated, abnormal processing can change the peptide's behavior, a point that is central to its role in disease (see Safety and risks).
The 37-residue sequence and approximate molecular weight above are well established in the biochemistry literature. Many shorter fragments and engineered analogs of LL-37 (for example KR-12 and others) exist in research and can have substantially different properties from the full-length peptide; this entry concerns full-length, naturally occurring LL-37 unless otherwise noted.
Biological roles and mechanism
LL-37 is frequently described as a "multifunctional" or "factotum" peptide because of how many distinct activities have been attributed to it. These fall into a few broad categories.
Direct antimicrobial activity
LL-37 has broad-spectrum activity reported against Gram-positive and Gram-negative bacteria, and activity against some fungi and enveloped viruses. The leading mechanism is membrane disruption: the cationic peptide is attracted to the negatively charged surfaces of microbial membranes, inserts into and permeabilizes them via its amphipathic helix. LL-37 can also bind and neutralize LPS (endotoxin), dampening one of the strongest pro-inflammatory bacterial signals.
Immunomodulation and chemotaxis
Beyond killing microbes directly, LL-37 acts as a signaling molecule that helps coordinate the immune response, a role sometimes described as an "alarmin." It is chemotactic, recruiting neutrophils, monocytes, and T cells, an effect attributed substantially to the receptor FPR2 (also called FPRL1), a G protein-coupled formyl-peptide receptor. It can influence cytokine production, dendritic-cell maturation, neutrophil survival, and the balance between pro- and anti-inflammatory signaling depending on context and concentration.
Angiogenesis and wound healing
LL-37 has been reported to promote angiogenesis (formation of new blood vessels), again partly through FPR2/FPRL1 on endothelial cells, with supporting data from chick chorioallantoic membrane assays and rabbit hindlimb ischemia models (Koczulla et al., 2003). It is also implicated in re-epithelialization and wound healing, consistent with its expression at epithelial surfaces and in healing wounds.
Vitamin D regulation
A key regulatory feature is that expression of the CAMP gene (which encodes hCAP-18/LL-37) is strongly induced by the vitamin D receptor (VDR) and its active ligand 1α,25-dihydroxyvitamin D3, particularly in macrophages and epithelial cells. Toll-like receptor activation during infection can upregulate the machinery that locally generates active vitamin D, which in turn drives cathelicidin expression. This vitamin D-cathelicidin axis is one reason vitamin D status has been studied in the context of antimicrobial defense (Lowry et al., 2014).
Receptor assignments (notably FPR2/FPRL1) and many downstream pathways come largely from in vitro and animal models. LL-37 interacts with multiple receptors and binding partners, and its effects can flip with concentration, cell type, and the presence of other molecules (DNA, RNA, lipids, serum proteins). "LL-37 does X" is therefore usually shorthand for "LL-37 did X in a particular experimental context."
LL-37 is one of several endogenous peptides studied for immune-related activity. Readers comparing immune-modulating peptides may also look at Thymosin Alpha-1, which has a distinct mechanism and a different (and more clinically developed) evidence profile.
Research and evidence
The LL-37 literature is large but dominated by in vitro and animal studies and by descriptive associations in human disease tissue. There is no approved LL-37 therapeutic. The one area with controlled human data is topical wound healing: small randomized, placebo-controlled trials have applied LL-37 to chronic wounds. An early dose-finding trial in venous leg ulcers reported the peptide was well tolerated with an efficacy signal at lower doses (Grönberg et al., 2014); a larger Phase IIb trial (148 patients) did not meet its primary endpoint across the whole cohort but suggested benefit in a large-ulcer subgroup with good tolerability (Mahlapuu et al., 2021); and a small trial reported faster healing of diabetic foot ulcers with topical LL-37 (Miranda et al., 2023). Outside of these small topical studies the evidence is preclinical, and there is no systemic human dosing data.
| Research area | Evidence type | Notes |
|---|---|---|
| Direct antimicrobial activity | In vitro, biochemical | Well documented in the lab; clinical use as a drug not established |
| Immunomodulation / chemotaxis | In vitro, animal | Mechanistic; concentration- and context-dependent |
| Angiogenesis / wound healing | In vitro, animal | Supportive preclinical data; double-edged implications |
| Autoimmune disease (psoriasis, lupus, rosacea) | Human tissue, animal, mechanistic | LL-37 implicated as a driver, not a treatment |
| Cancer | In vitro, animal, expression studies | Context-dependent; both pro- and anti-tumor |
| Human therapeutic dosing | Small topical RCTs only | Topical wound-healing trials done; mixed efficacy, generally well tolerated. No systemic dosing established |
The double-edged theme
What makes LL-37 distinctive is not a single headline finding but a recurring pattern: the same activities that are protective can become harmful when dysregulated. Chemotaxis and immune activation help fight infection but can sustain chronic inflammation; angiogenesis aids wound healing but can support tumor blood supply; the ability to complex with nucleic acids enhances some immune responses but can break self-tolerance. Much LL-37 research is therefore concerned with understanding when and why the balance tips, rather than establishing it as a straightforward beneficial agent.
Safety and risks
LL-37's safety profile cannot be summarized as "safe because it is natural." The honest position is that its risks are biologically plausible and partly demonstrated, while its safety as an administered agent in humans is essentially uncharacterized.
Pro-inflammatory and autoimmune associations
- Psoriasis. LL-37 is overexpressed in psoriatic skin. It can bind extracellular self-DNA released from dying cells and convert otherwise inert self-DNA into a potent trigger for plasmacytoid dendritic cells (pDCs) via TLR9, driving type I interferon production and an auto-inflammatory cascade. LL-37 has also been identified as a T-cell autoantigen in some psoriasis patients (Dombrowski & Schauber, 2012; Pahar et al., 2020).
- Systemic lupus erythematosus (SLE). In lupus, neutrophil extracellular traps (NETs) release LL-37 complexed with self-DNA; these complexes activate pDCs and can provoke autoantibodies against DNA and against the peptide itself, contributing to chronic autoimmunity (Moreno-Angarita et al., 2019).
- Rosacea. Abnormal proteolytic processing of cathelicidin (driven in part by elevated kallikrein 5 activity) generates pro-inflammatory LL-37 fragments; injecting these into mouse skin produced rosacea-like inflammation, implicating cathelicidin dysregulation in rosacea pathology (Yamasaki et al., 2007).
Cancer — context-dependence, not a clean story
LL-37 has dual, context-dependent effects in cancer. Reviews describe it as appearing to promote tumorigenesis in some cancers (for example ovarian, lung, and breast, where it has been associated with proliferation, angiogenesis, and stromal-cell recruitment) while appearing anti-tumor in others (for example colon and gastric cancer, where it has been linked to apoptosis and growth suppression). The direction of effect seems to depend on cancer type, receptor expression, peptide concentration, disease stage, and the tumor microenvironment (Piktel et al., 2015; Chen et al., 2018). This means LL-37 cannot be characterized as simply "anti-cancer" or "pro-cancer."
Unknowns — being candid
- No established systemic dosing. Controlled human experience is limited to small topical wound-healing trials; there are no validated systemic dosing regimens, and the pharmacokinetics, biodistribution, and dose-response of systemically administered LL-37 in people are not defined.
- Concentration-dependent toxicity. At higher concentrations LL-37 can be cytotoxic to host cells, not only microbes, which is one reason it is hard to use as a drug.
- Immunogenicity and autoimmunity risk. Given its documented role in breaking self-tolerance (psoriasis, lupus), introducing additional LL-37 raises plausible theoretical concerns that have not been resolved.
- Product quality. Material sold as "LL-37" outside regulated channels is not manufactured to pharmaceutical standards; identity, purity, and dosing accuracy are not guaranteed, an independent safety concern.
Risks are plausible and partly demonstrated
Because LL-37 is implicated in psoriasis, lupus, and rosacea, and has context-dependent (including pro-tumor) effects in cancer, the assumption that administering it would be beneficial or harmless is not supported. Its safety as an exogenous agent in humans is uncharacterized. This entry is educational and does not provide dosing, sourcing, or administration guidance.
How it compares
LL-37 is often grouped with other "immune peptides," but its biology and evidence profile differ sharply from a peptide like Thymosin Alpha-1. The contrast is useful for placing LL-37 accurately.
| LL-37 (cathelicidin) | Thymosin Alpha-1 | |
|---|---|---|
| Origin | Endogenous; C-terminal fragment of hCAP-18 (CAMP gene), 37 residues | Endogenous; N-terminally acetylated fragment of prothymosin alpha, 28 residues |
| Primary role | Direct antimicrobial (membrane disruption, LPS neutralization) plus broad immunomodulation | Predominantly immunomodulatory: promotes T-cell maturation and skews immune responses; no notable direct microbicidal action |
| Mechanism flavor | Cationic, amphipathic membrane-active peptide; also an "alarmin" signaling via FPR2 and other receptors | Acts largely through Toll-like receptor signaling on immune cells; not membrane-lytic |
| Double-edged liability | Pronounced; implicated in psoriasis, lupus, rosacea; context-dependent in cancer | Generally framed as an immune-restorative; far less associated with driving autoimmunity |
| Approval / evidence status | Not approved anywhere; controlled human data limited to small topical wound-healing trials | Approved/marketed in a number of countries (e.g. as thymalfasin/Zadaxin) for select indications; broader clinical-trial track record |
The practical takeaway: LL-37 is best understood as an endogenous antimicrobial effector with double-edged immune consequences and only early topical human data, whereas Thymosin Alpha-1 is primarily an immunomodulator with a more developed clinical and regulatory footprint. Neither comparison implies LL-37 is interchangeable with, or as well characterized as, an approved agent.
Status and regulation
LL-37 is an endogenous human peptide, not a marketed drug. It has not been approved by the U.S. FDA, the European Medicines Agency, or other major regulators for any therapeutic use. Research interest is substantial, including engineered LL-37-derived analogs and mimetics aimed at antimicrobial or anticancer applications. Full-length LL-37 itself has reached early-phase human trials only in topical wound healing, where results have been mixed (a Phase IIb venous leg-ulcer trial missed its primary endpoint), and it faces well-known development hurdles (host-cell toxicity at higher doses, protease sensitivity, and its double-edged immunobiology). No systemic LL-37 therapeutic has been approved or established.
Synthetic LL-37 marketed as a "research chemical" is commonly sold labeled "for research use only, not for human consumption." Because it is not an approved medicine or a lawfully marketed supplement, claims about therapeutic benefit in humans are not regulator-vetted.
Regulatory and research status can change. The specific status of LL-37 and its analogs should be verified against current primary sources (regulatory agencies and PubMed/PMC) rather than assumed from this snapshot.
Common misconceptions
- "LL-37 is just an antibiotic / immune booster, so more is better." Its biology is double-edged. The same activities that help in host defense can drive chronic inflammation, autoimmunity, and (in some settings) tumor growth.
- "It's natural and made by the body, so it's safe to take." Being endogenous does not establish that administering extra LL-37 is safe or beneficial; at higher concentrations it can be toxic to human cells, and it is mechanistically linked to autoimmune disease.
- "LL-37 is anti-cancer." The evidence is context-dependent: it promotes some cancers and suppresses others. It cannot be described as simply anti-cancer.
- "There are established human dosing protocols." There are not. The only controlled human data come from small topical wound-healing trials; there is no established systemic dosing, and LL-37 is not an approved drug.
- "Cathelicidin and LL-37 are entirely different things." LL-37 is the active C-terminal peptide of the human cathelicidin precursor hCAP-18; "cathelicidin" and "LL-37" are often used closely, though cathelicidin technically refers to the broader family/precursor.
This article summarizes published research for educational purposes only. It is not medical advice and is not a recommendation to obtain, possess, or use LL-37. Where evidence is preclinical, associative, or double-edged, that has been stated plainly.
References
- 1.A comprehensive summary of LL-37, the factotum human cathelicidin peptide — Vandamme D, Landuyt B, Luyten W, Schoofs L, Cellular Immunology, 2012. source
- 2.Spotlight on Human LL-37, an Immunomodulatory Peptide with Promising Cell-Penetrating Properties — Seil M, Nagant C, Dehaye JP, Vandenbranden M, Lensink MF, Pharmaceuticals (Basel), 2010. source
- 3.An angiogenic role for the human peptide antibiotic LL-37/hCAP-18 — Koczulla R, von Degenfeld G, Kupatt C, et al., Journal of Clinical Investigation, 2003. source
- 4.Regulation of the human cathelicidin antimicrobial peptide gene by 1α,25-dihydroxyvitamin D3 in primary immune cells — Lowry MB, Guo C, Borregaard N, Gombart AF, Journal of Steroid Biochemistry and Molecular Biology, 2014. source
- 5.Cathelicidin LL-37: a defense molecule with a potential role in psoriasis pathogenesis — Dombrowski Y, Schauber J, Experimental Dermatology, 2012. source
- 6.Immunomodulatory Role of the Antimicrobial LL-37 Peptide in Autoimmune Diseases and Viral Infections — Pahar B, Madonna S, Das A, Albanesi C, Girolomoni G, Vaccines (Basel), 2020. source
- 7.Cathelicidin LL-37: A new important molecule in the pathophysiology of systemic lupus erythematosus — Moreno-Angarita A, Aragón CC, Tobón GJ, Journal of Translational Autoimmunity, 2019. source
- 8.Increased serine protease activity and cathelicidin promotes skin inflammation in rosacea — Yamasaki K, Di Nardo A, Bardan A, et al., Nature Medicine, 2007. source
- 9.The Role of Cathelicidin LL-37 in Cancer Development — Piktel E, Niemirowicz K, Wnorowska U, et al., Archivum Immunologiae et Therapiae Experimentalis (Warsz), 2015. source
- 10.Roles and Mechanisms of Human Cathelicidin LL-37 in Cancer — Chen X, Zou X, Qi G, et al., Cellular Physiology and Biochemistry, 2018. source
- 11.Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial — Grönberg A, Mahlapuu M, Ståhle M, Whately-Smith C, Rollman O, Wound Repair and Regeneration, 2014. source
- 12.Evaluation of LL-37 in healing of hard-to-heal venous leg ulcers: A multicentric prospective randomized placebo-controlled clinical trial — Mahlapuu M, et al., Wound Repair and Regeneration, 2021. source
- 13.Efficacy of LL-37 cream in enhancing healing of diabetic foot ulcer: a randomized double-blind controlled trial — Miranda E, Bramono K, Yunir E, et al., Archives of Dermatological Research, 2023. source
Legal status (Europe)
17 major European markets we track — not an exhaustive list of Europe · as of June 2026
Research-reagent classification only, dated June 2026 — not legal advice. “No specific ban” means a compound is not specifically prohibited, never that human use is lawful.
See the full European legality map for how this is classified, what each label means, and the sources.
Frequently asked questions
- What is LL-37?
- The only human cathelicidin antimicrobial peptide, a 37-residue fragment released from the precursor protein hCAP-18. It is an endogenous component of innate immunity with direct antimicrobial, immunomodulatory, chemotactic, angiogenic, and wound-healing activities, but it has strikingly double-edged biology, it is also implicated in inflammatory and autoimmune diseases and has context-dependent roles in cancer. It is not an approved drug; the only controlled human data come from small topical wound-healing trials, with no systemic dosing established.
- Is LL-37 approved as a medicine, and where?
- No. LL-37 is not an approved medicine anywhere. It is handled as a research chemical, with only limited or early-stage human data.
- What is LL-37 studied for?
- LL-37 is most often discussed in the context of immune support. Research has examined Innate immunity and host defense, Immunomodulation, chemotaxis, and angiogenesis, and Autoimmunity (psoriasis, lupus, rosacea) and cancer biology. Being studied for an area does not mean it is proven or approved for it.
- Does LL-37 have human clinical trials?
- Only to a limited extent. A small number of early-stage human studies exist, but the evidence is preliminary and LL-37 is not approved.
Educational disclaimer. This article summarizes published research for informational purposes and is not medical advice. LL-37 is a research chemical not approved for human use. Consult a qualified healthcare professional before making health decisions.