Skip to content
Index by category

Signalling pathway

The incretin–glucagon receptor axis

A source-bound map of mature human GLP-1, GIP and glucagon ligands, their class B1 receptors, and a separate receptor-level layer for five engineered agonists.

Updated: 2026-08-22

Endogenous source-bound relation map

MoleculeTypeReceptor / targetRelationEvidence classSources
GLP-1(7-36)amideEndogenous ligandGLP1RGlucagon-like peptide 1 receptorAgonistCanonical endogenous agonismGs → adenylyl cyclase → cAMPCurated receptor pharmacology123
GLP-1(7-37)Endogenous ligandGLP1RGlucagon-like peptide 1 receptorAgonistCanonical endogenous agonismGs → adenylyl cyclase → cAMPCurated receptor pharmacology12
GIP(1-42)Endogenous ligandGIPRGastric inhibitory polypeptide receptorAgonistCanonical endogenous agonismGs → adenylyl cyclase → cAMPCurated receptor pharmacology123
Glucagon(1-29)Endogenous ligandGCGRGlucagon receptorAgonistCanonical endogenous agonismGs → adenylyl cyclase → cAMPCurated receptor pharmacology123
Glucagon(1-29)Endogenous ligandGLP1RGlucagon-like peptide 1 receptorAgonistCross-pharmacologyGs → adenylyl cyclase → cAMPCurated receptor pharmacology12

Engineered agonists — separate target layer

Each edge below comes from an agent-specific source. Status and receptor pharmacology are verified separately.

MoleculeTypeReceptor / targetRelationEvidence classSources
SemaglutideApproved medicineStatus reviewed: 2026-08-22Status source 1GLP1RGlucagon-like peptide 1 receptorAgonistEngineered receptor agonismOfficial product pharmacology1
TirzepatideApproved medicineStatus reviewed: 2026-08-22Status source 1GIPRGastric inhibitory polypeptide receptorAgonistEngineered receptor agonismOfficial product pharmacology1
TirzepatideApproved medicineStatus reviewed: 2026-08-22Status source 1GLP1RGlucagon-like peptide 1 receptorAgonistEngineered receptor agonismOfficial product pharmacology1
RetatrutideInvestigational compoundStatus reviewed: 2026-08-22Status source 1GIPRGastric inhibitory polypeptide receptorAgonistEngineered receptor agonismPrimary investigational pharmacology1
RetatrutideInvestigational compoundStatus reviewed: 2026-08-22Status source 1GLP1RGlucagon-like peptide 1 receptorAgonistEngineered receptor agonismPrimary investigational pharmacology1
RetatrutideInvestigational compoundStatus reviewed: 2026-08-22Status source 1GCGRGlucagon receptorAgonistEngineered receptor agonismPrimary investigational pharmacology1
SurvodutideInvestigational compoundStatus reviewed: 2026-08-22Status source 1GLP1RGlucagon-like peptide 1 receptorAgonistEngineered receptor agonismPrimary investigational pharmacology1
SurvodutideInvestigational compoundStatus reviewed: 2026-08-22Status source 1GCGRGlucagon receptorAgonistEngineered receptor agonismPrimary investigational pharmacology1
PemvidutideInvestigational compoundStatus reviewed: 2026-08-22Status source 1GLP1RGlucagon-like peptide 1 receptorAgonistEngineered receptor agonismPrimary investigational pharmacology12
PemvidutideInvestigational compoundStatus reviewed: 2026-08-22Status source 1GCGRGlucagon receptorAgonistEngineered receptor agonismPrimary investigational pharmacology12

Exact ligand identities

GLP-1(7-36)amide

Mature form
30-amino-acid C-terminally amidated peptide
Precursor gene
GCG
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

GLP-1(7-37)

Mature form
31-amino-acid non-amidated peptide
Precursor gene
GCG
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

GIP(1-42)

Mature form
42-amino-acid peptide
Precursor gene
GIP
Sequence
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Glucagon(1-29)

Mature form
29-amino-acid peptide
Precursor gene
GCG
Sequence
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT

Target nomenclature

GLP1R
Glucagon-like peptide 1 receptor
Protein components
GLP1R · UniProt P43220 · 463 amino acids
GIPR
Gastric inhibitory polypeptide receptor
Protein components
GIPR · UniProt P48546 · 466 amino acids
GCGR
Glucagon receptor
Protein components
GCGR · UniProt P47871 · 477 amino acids

Scope and definitions

This page maps human receptor pharmacology, not treatment. GLP-1 and GIP are incretin hormones. Glucagon belongs to the same class B1 receptor family but is not an incretin. The map separates a molecule's exact mature form, its receptor relation, the main curated transduction route, and the source that supports each edge.

Target nomenclature and curated receptor relations are attributed to the IUPHAR/BPS Guide to Pharmacology (GtoPdb) web services, accessed 22 August 2026; mature peptide and receptor identities are cross-checked against UniProt and the cited primary studies.

Ligand identity and precursor genes

Human GLP-1 occurs here as two mature products: the 30-residue C-terminally amidated GLP-1(7-36)amide and the 31-residue GLP-1(7-37). Both are processed from the GCG precursor. Human glucagon(1-29) is also processed from GCG. There is no separate human GLP1 gene for these peptides; sharing a precursor does not mean that the products are processed or released identically in every tissue.

Human GIP(1-42) is processed from the separate GIP precursor. “Gastric inhibitory polypeptide” is the UniProt/GtoPdb name; “glucose-dependent insulinotropic polypeptide” is an established alternative name.

Shared signalling spine

GLP1R, GIPR and GCGR are human class B1 G-protein-coupled receptors. Their principal curated transduction route is Gs → adenylyl cyclase → increased intracellular cAMP. Structural work also resolves the three cognate ligand–receptor–Gs complexes.

That shared spine does not make the receptors interchangeable. It does not establish identical effects across pancreas, liver, brain, adipose tissue or the gastrointestinal tract. It is also not an “only Gs” claim: structural evidence shows that human GCGR can recognise both Gs and Gi.

Canonical relations and cross-pharmacology

The canonical endogenous relations are GLP-1(7-36)amide and GLP-1(7-37) → GLP1R, GIP(1-42) → GIPR, and glucagon(1-29) → GCGR. GtoPdb also records glucagon as an agonist at human GLP1R. In one primary human-receptor assay, glucagon behaved as a full agonist but was about 200-fold less potent than GLP-1(7-36)amide. That is an assay-specific cross-pharmacology result, not a redefinition of glucagon's canonical physiological pathway.

Absence of another relation from a curated registry does not prove biological impossibility. Potency, efficacy, receptor reserve, bias, internalisation and β-arrestin outcomes must remain tied to the ligand, species and assay system in which they were measured.

Engineered agonist layer

The separate engineered layer does not infer a drug relation from the endogenous map. Every edge has an agent-specific source: semaglutide → GLP1R; tirzepatide → GIPR and GLP1R; retatrutide → GIPR, GLP1R and GCGR; and survodutide and pemvidutide → GLP1R and GCGR.

“Approved medicine” means that a current official product label supports both medicine status and the stated receptor pharmacology for at least one product in the cited jurisdiction. It is not a blanket approval claim for every formulation, indication or country. “Investigational compound” is a dated development-status classification supported by the cited trial registry; registration or publication is not approval.

The edges show target activity only. They do not rank potency, balance, bias or clinical performance between agents, and they do not assign a share of an observed clinical outcome to any one receptor.

What this map cannot establish

A receptor edge cannot by itself establish insulin secretion, appetite change, gastric emptying, lipolysis, energy expenditure, weight change, safety or clinical benefit. Those claims require their own tissue, animal, human or regulatory evidence. The engineered layer therefore links to the full monographs instead of allowing receptor activity to inherit their clinical claims.

References

  1. 1.UniProt human proglucagon (GCG), P01275 UniProt Consortium (2026).
  2. 2.UniProt human GIP precursor, P09681 UniProt Consortium (2026).
  3. 3.UniProt human GLP-1 receptor, P43220 UniProt Consortium (2026).
  4. 4.UniProt human GIP receptor, P48546 UniProt Consortium (2026).
  5. 5.UniProt human glucagon receptor, P47871 UniProt Consortium (2026).
  6. 6.GtoPdb ligand 1132 — GLP-1(7-36)amide IUPHAR/BPS Guide to Pharmacology (2026).
  7. 7.GtoPdb ligand 3544 — GLP-1(7-37) IUPHAR/BPS Guide to Pharmacology (2026).
  8. 8.GtoPdb GLP1R natural ligands IUPHAR/BPS Guide to Pharmacology (2026).
  9. 9.GtoPdb human GLP1R interactions IUPHAR/BPS Guide to Pharmacology (2026).
  10. 10.GtoPdb ligand 3542 — human GIP IUPHAR/BPS Guide to Pharmacology (2026).
  11. 11.GtoPdb GIPR natural ligands IUPHAR/BPS Guide to Pharmacology (2026).
  12. 12.GtoPdb ligand 1136 — glucagon IUPHAR/BPS Guide to Pharmacology (2026).
  13. 13.GtoPdb GCGR natural ligands IUPHAR/BPS Guide to Pharmacology (2026).
  14. 14.Functional expression of the human GLP-1 receptor Dillon JS, Tanizawa Y, Wheeler MB, et al. (1993).
  15. 15.Structure of the GLP-1 receptor in complex with GLP-1 and Gs Zhang Y, Sun B, Feng D, et al. (2017).
  16. 16.Molecular cloning and functional expression of the human GIP receptor Volz A, Göke R, Lankat-Buttgereit B, et al. (1995).
  17. 17.Structural basis of Gs and Gi recognition by the human glucagon receptor Qiao A, Han S, Li X, et al. (2020).
  18. 18.Structural insights into hormone recognition by the human class B1 receptor family Zhao F, Zhang C, Zhou Q, et al. (2022).
  19. 19.GtoPdb downloads, licensing and citation guidance IUPHAR/BPS Guide to Pharmacology (2026).
  20. 20.OZEMPIC (semaglutide) — current US prescribing information U.S. National Library of Medicine / Novo Nordisk (2026).
  21. 21.MOUNJARO (tirzepatide) — current US prescribing information U.S. National Library of Medicine / Eli Lilly and Company (2026).
  22. 22.Retatrutide in type 2 diabetes — TRANSCEND-T2D-1 phase 3 trial Bajaj HS, Welch M, Shah P, et al. (2026).
  23. 23.TRIUMPH-1 phase 3 retatrutide registry — NCT05929066 Eli Lilly and Company (2026).
  24. 24.BI 456906: discovery and preclinical pharmacology of a GCGR/GLP-1R dual agonist Zimmermann T, Thomas L, Baader-Pagler T, et al. (2022).
  25. 25.SYNCHRONIZE-1 phase 3 survodutide registry — NCT06066515 Boehringer Ingelheim (2026).
  26. 26.Pemvidutide, a GLP-1/glucagon dual receptor agonist, in MASLD Harrison SA, Bedossa P, Guy CD, et al. (2024).
  27. 27.FDA GSRS identity and target record for pemvidutide, UNII A35F525WBG U.S. Food and Drug Administration (2026).
  28. 28.IMPACT phase 2b pemvidutide registry — NCT05989711 Altimmune, Inc. (2026).